Added option to keep master pass in text field, off by default

OnePass/App.config

@@ -1,6 +1,6 @@
-<?xml version="1.0" encoding="utf-8" ?>
+<?xml version="1.0" encoding="utf-8"?>
 <configuration>
     <startup> 
-        <supportedRuntime version="v4.0" sku=".NETFramework,Version=v4.7.2" />
+        <supportedRuntime version="v4.0" sku=".NETFramework,Version=v4.7.2"/>
     </startup>
-</configuration>
+</configuration>

OnePass/Form1.Designer.cs

@@ -47,13 +47,19 @@ namespace OnePass
             this.numbers = new System.Windows.Forms.Label();
             this.special = new System.Windows.Forms.Label();
             this.extspc = new System.Windows.Forms.Label();
+            this.help = new System.Windows.Forms.Button();
+            this.save_login = new System.Windows.Forms.Button();
+            this.load_login = new System.Windows.Forms.Button();
+            this.label7 = new System.Windows.Forms.Label();
+            this.checkBox1 = new System.Windows.Forms.CheckBox();
+            this.keep_chk = new System.Windows.Forms.CheckBox();
             ((System.ComponentModel.ISupportInitialize)(this.passCycle)).BeginInit();
             ((System.ComponentModel.ISupportInitialize)(this.passLength)).BeginInit();
             this.SuspendLayout();
             // 
             // Generate
             // 
-            this.Generate.Location = new System.Drawing.Point(259, 149);
+            this.Generate.Location = new System.Drawing.Point(259, 154);
             this.Generate.Name = "Generate";
             this.Generate.Size = new System.Drawing.Size(109, 20);
             this.Generate.TabIndex = 0;
@@ -63,9 +69,9 @@ namespace OnePass
             // 
             // passCycle
             // 
-            this.passCycle.Location = new System.Drawing.Point(209, 149);
+            this.passCycle.Location = new System.Drawing.Point(209, 154);
             this.passCycle.Maximum = new decimal(new int[] {
-            1000,
+            9999,
             0,
             0,
             0});
@@ -75,9 +81,9 @@ namespace OnePass
             // 
             // passLength
             // 
-            this.passLength.Location = new System.Drawing.Point(112, 150);
+            this.passLength.Location = new System.Drawing.Point(112, 155);
             this.passLength.Maximum = new decimal(new int[] {
-            64,
+            128,
             0,
             0,
             0});
@@ -99,7 +105,7 @@ namespace OnePass
             // 
             this.label1.AutoSize = true;
             this.label1.Font = new System.Drawing.Font("Segoe UI", 9F, System.Drawing.FontStyle.Bold);
-            this.label1.Location = new System.Drawing.Point(164, 152);
+            this.label1.Location = new System.Drawing.Point(164, 157);
             this.label1.Name = "label1";
             this.label1.Size = new System.Drawing.Size(39, 15);
             this.label1.TabIndex = 4;
@@ -109,7 +115,7 @@ namespace OnePass
             // 
             this.label2.AutoSize = true;
             this.label2.Font = new System.Drawing.Font("Segoe UI", 9F, System.Drawing.FontStyle.Bold);
-            this.label2.Location = new System.Drawing.Point(10, 151);
+            this.label2.Location = new System.Drawing.Point(10, 156);
             this.label2.Name = "label2";
             this.label2.Size = new System.Drawing.Size(101, 15);
             this.label2.TabIndex = 5;
@@ -152,21 +158,21 @@ namespace OnePass
             // 
             this.sitename.Location = new System.Drawing.Point(43, 6);
             this.sitename.Name = "sitename";
-            this.sitename.Size = new System.Drawing.Size(325, 20);
+            this.sitename.Size = new System.Drawing.Size(321, 20);
             this.sitename.TabIndex = 9;
             // 
             // username
             // 
             this.username.Location = new System.Drawing.Point(43, 31);
             this.username.Name = "username";
-            this.username.Size = new System.Drawing.Size(325, 20);
+            this.username.Size = new System.Drawing.Size(321, 20);
             this.username.TabIndex = 10;
             // 
             // masterpass
             // 
             this.masterpass.Location = new System.Drawing.Point(107, 56);
             this.masterpass.Name = "masterpass";
-            this.masterpass.Size = new System.Drawing.Size(261, 20);
+            this.masterpass.Size = new System.Drawing.Size(257, 20);
             this.masterpass.TabIndex = 11;
             this.masterpass.UseSystemPasswordChar = true;
             // 
@@ -175,7 +181,7 @@ namespace OnePass
             this.label6.AutoSize = true;
             this.label6.Font = new System.Drawing.Font("Segoe UI", 9F, System.Drawing.FontStyle.Bold);
             this.label6.ImageAlign = System.Drawing.ContentAlignment.MiddleLeft;
-            this.label6.Location = new System.Drawing.Point(3, 77);
+            this.label6.Location = new System.Drawing.Point(3, 82);
             this.label6.Name = "label6";
             this.label6.Size = new System.Drawing.Size(53, 15);
             this.label6.TabIndex = 12;
@@ -187,7 +193,7 @@ namespace OnePass
             this.atoz.BackColor = System.Drawing.SystemColors.Highlight;
             this.atoz.BorderStyle = System.Windows.Forms.BorderStyle.FixedSingle;
             this.atoz.Font = new System.Drawing.Font("Segoe UI", 20F);
-            this.atoz.Location = new System.Drawing.Point(17, 95);
+            this.atoz.Location = new System.Drawing.Point(17, 100);
             this.atoz.Name = "atoz";
             this.atoz.Size = new System.Drawing.Size(56, 39);
             this.atoz.TabIndex = 13;
@@ -200,7 +206,7 @@ namespace OnePass
             this.uAtoZ.BackColor = System.Drawing.SystemColors.Highlight;
             this.uAtoZ.BorderStyle = System.Windows.Forms.BorderStyle.FixedSingle;
             this.uAtoZ.Font = new System.Drawing.Font("Segoe UI", 20F);
-            this.uAtoZ.Location = new System.Drawing.Point(79, 95);
+            this.uAtoZ.Location = new System.Drawing.Point(79, 100);
             this.uAtoZ.Name = "uAtoZ";
             this.uAtoZ.Size = new System.Drawing.Size(62, 39);
             this.uAtoZ.TabIndex = 14;
@@ -213,7 +219,7 @@ namespace OnePass
             this.numbers.BackColor = System.Drawing.SystemColors.Highlight;
             this.numbers.BorderStyle = System.Windows.Forms.BorderStyle.FixedSingle;
             this.numbers.Font = new System.Drawing.Font("Segoe UI", 20F);
-            this.numbers.Location = new System.Drawing.Point(147, 95);
+            this.numbers.Location = new System.Drawing.Point(147, 100);
             this.numbers.Name = "numbers";
             this.numbers.Size = new System.Drawing.Size(60, 39);
             this.numbers.TabIndex = 15;
@@ -226,7 +232,7 @@ namespace OnePass
             this.special.BackColor = System.Drawing.SystemColors.Highlight;
             this.special.BorderStyle = System.Windows.Forms.BorderStyle.FixedSingle;
             this.special.Font = new System.Drawing.Font("Segoe UI", 20F);
-            this.special.Location = new System.Drawing.Point(213, 95);
+            this.special.Location = new System.Drawing.Point(213, 100);
             this.special.Name = "special";
             this.special.Size = new System.Drawing.Size(69, 39);
             this.special.TabIndex = 16;
@@ -239,18 +245,93 @@ namespace OnePass
             this.extspc.BackColor = System.Drawing.SystemColors.InactiveCaption;
             this.extspc.BorderStyle = System.Windows.Forms.BorderStyle.FixedSingle;
             this.extspc.Font = new System.Drawing.Font("Segoe UI", 20F);
-            this.extspc.Location = new System.Drawing.Point(288, 95);
+            this.extspc.Location = new System.Drawing.Point(288, 100);
             this.extspc.Name = "extspc";
             this.extspc.Size = new System.Drawing.Size(76, 39);
             this.extspc.TabIndex = 17;
             this.extspc.Text = "Ext%";
             this.extspc.Click += new System.EventHandler(this.extspc_Click);
             // 
+            // help
+            // 
+            this.help.Location = new System.Drawing.Point(370, 6);
+            this.help.Name = "help";
+            this.help.Size = new System.Drawing.Size(52, 23);
+            this.help.TabIndex = 18;
+            this.help.Text = "Help";
+            this.help.UseVisualStyleBackColor = true;
+            this.help.Click += new System.EventHandler(this.help_Click);
+            // 
+            // save_login
+            // 
+            this.save_login.Location = new System.Drawing.Point(370, 29);
+            this.save_login.Name = "save_login";
+            this.save_login.Size = new System.Drawing.Size(52, 23);
+            this.save_login.TabIndex = 19;
+            this.save_login.Text = "Save";
+            this.save_login.UseVisualStyleBackColor = true;
+            this.save_login.Click += new System.EventHandler(this.save_login_Click);
+            // 
+            // load_login
+            // 
+            this.load_login.Location = new System.Drawing.Point(370, 53);
+            this.load_login.Name = "load_login";
+            this.load_login.Size = new System.Drawing.Size(52, 23);
+            this.load_login.TabIndex = 20;
+            this.load_login.Text = "Load";
+            this.load_login.UseVisualStyleBackColor = true;
+            this.load_login.Click += new System.EventHandler(this.load_login_Click);
+            // 
+            // label7
+            // 
+            this.label7.AutoSize = true;
+            this.label7.BackColor = System.Drawing.SystemColors.InactiveCaption;
+            this.label7.BorderStyle = System.Windows.Forms.BorderStyle.FixedSingle;
+            this.label7.Font = new System.Drawing.Font("Segoe UI", 20F);
+            this.label7.Location = new System.Drawing.Point(370, 100);
+            this.label7.Name = "label7";
+            this.label7.Size = new System.Drawing.Size(49, 39);
+            this.label7.TabIndex = 21;
+            this.label7.Text = "Pn";
+            this.label7.Click += new System.EventHandler(this.label7_Click);
+            // 
+            // checkBox1
+            // 
+            this.checkBox1.AutoSize = true;
+            this.checkBox1.Font = new System.Drawing.Font("Segoe UI", 9F, System.Drawing.FontStyle.Bold);
+            this.checkBox1.Location = new System.Drawing.Point(371, 79);
+            this.checkBox1.Name = "checkBox1";
+            this.checkBox1.Size = new System.Drawing.Size(57, 19);
+            this.checkBox1.TabIndex = 24;
+            this.checkBox1.Text = "Show";
+            this.checkBox1.TextAlign = System.Drawing.ContentAlignment.MiddleCenter;
+            this.checkBox1.UseVisualStyleBackColor = true;
+            this.checkBox1.CheckedChanged += new System.EventHandler(this.checkBox1_CheckedChanged);
+            // 
+            // keep_chk
+            // 
+            this.keep_chk.AutoSize = true;
+            this.keep_chk.Font = new System.Drawing.Font("Segoe UI", 9F, System.Drawing.FontStyle.Bold);
+            this.keep_chk.Location = new System.Drawing.Point(314, 79);
+            this.keep_chk.Name = "keep_chk";
+            this.keep_chk.Size = new System.Drawing.Size(55, 19);
+            this.keep_chk.TabIndex = 25;
+            this.keep_chk.Text = "Keep";
+            this.keep_chk.TextAlign = System.Drawing.ContentAlignment.MiddleCenter;
+            this.keep_chk.UseVisualStyleBackColor = true;
+            this.keep_chk.CheckedChanged += new System.EventHandler(this.keep_chk_CheckedChanged);
+            // 
             // Form1
             // 
             this.AutoScaleDimensions = new System.Drawing.SizeF(6F, 13F);
             this.AutoScaleMode = System.Windows.Forms.AutoScaleMode.Font;
-            this.ClientSize = new System.Drawing.Size(380, 180);
+            this.ClientSize = new System.Drawing.Size(426, 183);
+            this.Controls.Add(this.keep_chk);
+            this.Controls.Add(this.checkBox1);
+            this.Controls.Add(this.label7);
+            this.Controls.Add(this.load_login);
+            this.Controls.Add(this.save_login);
+            this.Controls.Add(this.help);
             this.Controls.Add(this.extspc);
             this.Controls.Add(this.special);
             this.Controls.Add(this.numbers);
@@ -269,10 +350,11 @@ namespace OnePass
             this.Controls.Add(this.passCycle);
             this.Controls.Add(this.Generate);
             this.Icon = ((System.Drawing.Icon)(resources.GetObject("$this.Icon")));
-            this.MaximumSize = new System.Drawing.Size(396, 219);
-            this.MinimumSize = new System.Drawing.Size(396, 219);
+            this.MaximumSize = new System.Drawing.Size(442, 222);
+            this.MinimumSize = new System.Drawing.Size(442, 222);
             this.Name = "Form1";
-            this.Text = "OnePass V2.0";
+            this.Text = "OnePass V5.2.1";
+            this.Load += new System.EventHandler(this.Form1_Load);
             ((System.ComponentModel.ISupportInitialize)(this.passCycle)).EndInit();
             ((System.ComponentModel.ISupportInitialize)(this.passLength)).EndInit();
             this.ResumeLayout(false);
@@ -299,6 +381,12 @@ namespace OnePass
         private System.Windows.Forms.Label numbers;
         private System.Windows.Forms.Label special;
         private System.Windows.Forms.Label extspc;
+        private System.Windows.Forms.Button help;
+        private System.Windows.Forms.Button save_login;
+        private System.Windows.Forms.Button load_login;
+        private System.Windows.Forms.Label label7;
+        private System.Windows.Forms.CheckBox checkBox1;
+        private System.Windows.Forms.CheckBox keep_chk;
     }
 }
 

OnePass/Form1.cs

@@ -1,21 +1,79 @@
 using System;
 using System.Collections;
+using System.Collections.Generic;
+using System.Drawing;
+using System.IO;
 using System.Text;
 using System.Threading;
+using System.Windows;
 using System.Windows.Forms;
 
 namespace OnePass
 {
     public partial class Form1 : Form
     {
+        private Form2 form2 = new Form2();
         public Form1()
         {
+            Directory.CreateDirectory(form2.path);
             InitializeComponent();
         }
 
+
+
+        string vowels = "aaaaaeeeeeeeiiiiiooooouuu";
+        string consonants = "bbcccdddfffgghhhhjklllmmmnnnnnpprrrrrsssssttttttvwwxyyz";
+
+        string[] vowelafter = { "th", "ch", "sh", "qu" };
+        string[] consonantafter = { "oo", "ee" };
+
+        public string GeneratePassword(int length, int seed)
+        {
+            Random rnd = new Random(seed);
+            string pass = "";
+            bool isvowel = false;
+
+            for (int i = 0; i < length; i++)
+            {
+                if (isvowel)
+                {
+                    if (rnd.Next(0, 5) == 0 && i < (length - 1))
+                    {
+                        pass += consonantafter[rnd.Next(0, consonantafter.Length)];
+                    }
+                    else
+                    {
+                        pass += vowels.Substring(rnd.Next(0, vowels.Length), 1);
+                    }
+                }
+                else
+                {
+                    if (rnd.Next(0, 5) == 0 && i < (length - 1))
+                    {
+                        pass += vowelafter[rnd.Next(0, vowelafter.Length)];
+                    }
+                    else
+                    {
+                        pass += consonants.Substring(rnd.Next(0, consonants.Length), 1);
+                    }
+                }
+                isvowel = !isvowel;
+            }
+            return pass;
+        }//using Microsoft.WindowsAPICodePack.Dialogs;
+        private void label7_Click(object sender, EventArgs e)
+        {
+            label7.BackColor = System.Drawing.SystemColors.Highlight;
+            atoz.BackColor = System.Drawing.SystemColors.InactiveCaption;
+            uAtoZ.BackColor = System.Drawing.SystemColors.InactiveCaption;
+            numbers.BackColor = System.Drawing.SystemColors.InactiveCaption;
+            special.BackColor = System.Drawing.SystemColors.InactiveCaption;
+            extspc.BackColor = System.Drawing.SystemColors.InactiveCaption;
+        }
         private void atoz_Click(object sender, EventArgs e)
         {
-            if(atoz.BackColor == System.Drawing.SystemColors.InactiveCaption)
+            label7.BackColor = System.Drawing.SystemColors.InactiveCaption;
+            if (atoz.BackColor == System.Drawing.SystemColors.InactiveCaption)
             {
                 atoz.BackColor = System.Drawing.SystemColors.Highlight;
             } else
@@ -26,6 +84,7 @@ namespace OnePass
 
         private void uAtoZ_Click(object sender, EventArgs e)
         {
+            label7.BackColor = System.Drawing.SystemColors.InactiveCaption;
             if (uAtoZ.BackColor == System.Drawing.SystemColors.InactiveCaption)
             {
                 uAtoZ.BackColor = System.Drawing.SystemColors.Highlight;
@@ -38,6 +97,7 @@ namespace OnePass
 
         private void numbers_Click(object sender, EventArgs e)
         {
+            label7.BackColor = System.Drawing.SystemColors.InactiveCaption;
             if (numbers.BackColor == System.Drawing.SystemColors.InactiveCaption)
             {
                 numbers.BackColor = System.Drawing.SystemColors.Highlight;
@@ -50,6 +110,7 @@ namespace OnePass
 
         private void special_Click(object sender, EventArgs e)
         {
+            label7.BackColor = System.Drawing.SystemColors.InactiveCaption;
             if (special.BackColor == System.Drawing.SystemColors.InactiveCaption)
             {
                 special.BackColor = System.Drawing.SystemColors.Highlight;
@@ -62,7 +123,7 @@ namespace OnePass
 
         void addSpecial(ref ArrayList list)
         {
-            foreach(int c in new int[]{ 33,35,36,37,38,39,40,41,42,43,44,45,46,47,64 })
+            foreach (int c in new int[] { 33, 35, 36, 37, 38, 40, 41, 42, 43, 44, 45, 64 })
             {
                 list.Add(Char.ConvertFromUtf32(c));
             }
@@ -119,7 +180,7 @@ namespace OnePass
         {
             if (sitename.Text == "" || username.Text == "" || masterpass.Text == "")
             {
-                MessageBox.Show("Cannot leave a field blank!");
+                System.Windows.MessageBox.Show("Cannot leave a field blank!");
                 return;
             }
             ArrayList chars = new ArrayList();
@@ -133,9 +194,13 @@ namespace OnePass
                 addUpper(ref chars);
             if (extspc.BackColor == System.Drawing.SystemColors.Highlight)
                 addExtended(ref chars);
+            if(label7.BackColor == System.Drawing.SystemColors.Highlight)
+            {
+                chars.Add('A');
+            }
             if (chars.Count == 0)
             {
-                MessageBox.Show("Must have at least one option turned on to generate a password!");
+                System.Windows.MessageBox.Show("Must have at least one option turned on to generate a password!");
                 return;
             }
             byte[] sn_bytes = Encoding.ASCII.GetBytes(sitename.Text);
@@ -158,17 +223,23 @@ namespace OnePass
                 temp = b;
                 seed ^= (temp << (c++ % 8) * 8);
             }
-            Clipboard.SetText(GenerateKey((uint)passLength.Value, seed, ref chars));
-            Generate.Text = "Copied to Clipboard";
-            Generate.Enabled = false;
-            this.Update();
-            Thread.Sleep(1000);
-            Generate.Text = "Generate Password";
-            Generate.Enabled = true;
+            try
+            {
+                if (label7.BackColor == System.Drawing.SystemColors.Highlight)
+                    System.Windows.Clipboard.SetText(GeneratePassword((int)passLength.Value, (int)seed));
+                else
+                    System.Windows.Clipboard.SetText(GenerateKey((uint)passLength.Value, seed, ref chars));
+            } catch
+            {
+                System.Windows.MessageBox.Show("Attempt to capture clipboard data over the network! (Are you using remote desktop w/clipboard)");
+            }
+            if (!keep_chk.Checked)
+                masterpass.Text = "";
         }
 
         private void extspc_Click(object sender, EventArgs e)
         {
+            label7.BackColor = System.Drawing.SystemColors.InactiveCaption;
             if (extspc.BackColor == System.Drawing.SystemColors.InactiveCaption)
             {
                 extspc.BackColor = System.Drawing.SystemColors.Highlight;
@@ -178,5 +249,86 @@ namespace OnePass
                 extspc.BackColor = System.Drawing.SystemColors.InactiveCaption;
             }
         }
+
+        private void help_Click(object sender, EventArgs e)
+        {
+            System.Windows.MessageBox.Show("When a password is generated the password will live on your clipboard for 7 seconds (paste it quick). Then your master password and the clipboard is also cleared out! Make sure nothing important is on the clipboard!","Help!");
+        }
+        private string MakeValidFileName(string name)
+        {
+            string invalidChars = System.Text.RegularExpressions.Regex.Escape(new string(System.IO.Path.GetInvalidFileNameChars()));
+            string invalidRegStr = string.Format(@"([{0}]*\.+$)|([{0}]+)", invalidChars);
+
+            return form2.path + "\\" + System.Text.RegularExpressions.Regex.Replace(name, invalidRegStr, "_");
+        }
+        private void load_login_Click(object sender, EventArgs e)
+        {
+            form2.init();
+            this.Enabled = false;
+            form2.ShowDialog(this);
+            this.Enabled = true;
+            if (form2.state == true)
+            {
+                sitename.Text = form2.site;
+                username.Text = form2.login;
+                passCycle.Value = (decimal)form2.cycle;
+                passLength.Value = (decimal)form2.length;
+                special.BackColor = (form2.opt1) ? System.Drawing.SystemColors.Highlight : System.Drawing.SystemColors.InactiveCaption;
+                numbers.BackColor = (form2.opt2) ? System.Drawing.SystemColors.Highlight : System.Drawing.SystemColors.InactiveCaption;
+                atoz.BackColor = (form2.opt3) ? System.Drawing.SystemColors.Highlight : System.Drawing.SystemColors.InactiveCaption;
+                uAtoZ.BackColor = (form2.opt4) ? System.Drawing.SystemColors.Highlight : System.Drawing.SystemColors.InactiveCaption;
+                extspc.BackColor = (form2.opt5) ? System.Drawing.SystemColors.Highlight : System.Drawing.SystemColors.InactiveCaption;
+                label7.BackColor = (form2.opt6) ? System.Drawing.SystemColors.Highlight : System.Drawing.SystemColors.InactiveCaption;
+            }
+        }
+
+        private void save_login_Click(object sender, EventArgs e)
+        {
+            if(sitename.Text=="" || username.Text == "")
+            {
+                System.Windows.MessageBox.Show("Cannot save data if fields are incomplete!");
+                return;
+            }
+            try
+            {
+                BinaryWriter writer = new BinaryWriter(File.Open(MakeValidFileName(sitename.Text + username.Text), FileMode.Create));
+                writer.Write(sitename.Text);
+                writer.Write(username.Text);
+                writer.Write((int)passCycle.Value);
+                writer.Write((int)passLength.Value);
+                writer.Write(special.BackColor == System.Drawing.SystemColors.Highlight);
+                writer.Write(numbers.BackColor == System.Drawing.SystemColors.Highlight);
+                writer.Write(atoz.BackColor == System.Drawing.SystemColors.Highlight);
+                writer.Write(uAtoZ.BackColor == System.Drawing.SystemColors.Highlight);
+                writer.Write(extspc.BackColor == System.Drawing.SystemColors.Highlight);
+                writer.Write(label7.BackColor == System.Drawing.SystemColors.Highlight);
+                writer.Flush();
+                writer.Dispose();
+            }
+            catch(Exception ex)
+            {
+                System.Windows.MessageBox.Show(ex.Message);
+            }
+        }
+
+        private void label8_Click(object sender, EventArgs e)
+        {
+
+        }
+
+        private void checkBox1_CheckedChanged(object sender, EventArgs e)
+        {
+            masterpass.UseSystemPasswordChar = !checkBox1.Checked;
+        }
+
+        private void Form1_Load(object sender, EventArgs e)
+        {
+
+        }
+
+        private void keep_chk_CheckedChanged(object sender, EventArgs e)
+        {
+
+        }
     }
 }

OnePass/Form2.Designer.cs

@@ -0,0 +1,129 @@
+
+namespace OnePass
+{
+    partial class Form2
+    {
+        /// <summary>
+        /// Required designer variable.
+        /// </summary>
+        private System.ComponentModel.IContainer components = null;
+
+        /// <summary>
+        /// Clean up any resources being used.
+        /// </summary>
+        /// <param name="disposing">true if managed resources should be disposed; otherwise, false.</param>
+        protected override void Dispose(bool disposing)
+        {
+            if (disposing && (components != null))
+            {
+                components.Dispose();
+            }
+            base.Dispose(disposing);
+        }
+
+        #region Windows Form Designer generated code
+
+        /// <summary>
+        /// Required method for Designer support - do not modify
+        /// the contents of this method with the code editor.
+        /// </summary>
+        private void InitializeComponent()
+        {
+            System.ComponentModel.ComponentResourceManager resources = new System.ComponentModel.ComponentResourceManager(typeof(Form2));
+            this.Logins = new System.Windows.Forms.ListBox();
+            this.textBox1 = new System.Windows.Forms.TextBox();
+            this.select_login = new System.Windows.Forms.Button();
+            this.remove_login = new System.Windows.Forms.Button();
+            this.button1 = new System.Windows.Forms.Button();
+            this.button2 = new System.Windows.Forms.Button();
+            this.SuspendLayout();
+            // 
+            // Logins
+            // 
+            this.Logins.FormattingEnabled = true;
+            this.Logins.Location = new System.Drawing.Point(13, 26);
+            this.Logins.Name = "Logins";
+            this.Logins.Size = new System.Drawing.Size(296, 121);
+            this.Logins.TabIndex = 0;
+            // 
+            // textBox1
+            // 
+            this.textBox1.Enabled = false;
+            this.textBox1.Location = new System.Drawing.Point(13, 2);
+            this.textBox1.Name = "textBox1";
+            this.textBox1.Size = new System.Drawing.Size(296, 20);
+            this.textBox1.TabIndex = 1;
+            this.textBox1.Text = "Select a Stored Login";
+            // 
+            // select_login
+            // 
+            this.select_login.Location = new System.Drawing.Point(13, 152);
+            this.select_login.Name = "select_login";
+            this.select_login.Size = new System.Drawing.Size(84, 23);
+            this.select_login.TabIndex = 2;
+            this.select_login.Text = "Select Login Info";
+            this.select_login.UseVisualStyleBackColor = true;
+            this.select_login.Click += new System.EventHandler(this.select_login_Click);
+            // 
+            // remove_login
+            // 
+            this.remove_login.Location = new System.Drawing.Point(13, 179);
+            this.remove_login.Name = "remove_login";
+            this.remove_login.Size = new System.Drawing.Size(84, 23);
+            this.remove_login.TabIndex = 3;
+            this.remove_login.Text = "Delete Login Info";
+            this.remove_login.UseVisualStyleBackColor = true;
+            this.remove_login.Click += new System.EventHandler(this.remove_login_Click);
+            // 
+            // button1
+            // 
+            this.button1.Location = new System.Drawing.Point(222, 152);
+            this.button1.Name = "button1";
+            this.button1.Size = new System.Drawing.Size(87, 23);
+            this.button1.TabIndex = 4;
+            this.button1.Text = "Export Logins";
+            this.button1.UseVisualStyleBackColor = true;
+            this.button1.Click += new System.EventHandler(this.button1_Click);
+            // 
+            // button2
+            // 
+            this.button2.Location = new System.Drawing.Point(222, 179);
+            this.button2.Name = "button2";
+            this.button2.Size = new System.Drawing.Size(87, 23);
+            this.button2.TabIndex = 5;
+            this.button2.Text = "Import Logins";
+            this.button2.UseVisualStyleBackColor = true;
+            this.button2.Click += new System.EventHandler(this.button2_Click);
+            // 
+            // Form2
+            // 
+            this.AutoScaleDimensions = new System.Drawing.SizeF(6F, 13F);
+            this.AutoScaleMode = System.Windows.Forms.AutoScaleMode.Font;
+            this.ClientSize = new System.Drawing.Size(321, 207);
+            this.Controls.Add(this.button2);
+            this.Controls.Add(this.button1);
+            this.Controls.Add(this.remove_login);
+            this.Controls.Add(this.select_login);
+            this.Controls.Add(this.textBox1);
+            this.Controls.Add(this.Logins);
+            this.Icon = ((System.Drawing.Icon)(resources.GetObject("$this.Icon")));
+            this.MaximumSize = new System.Drawing.Size(337, 246);
+            this.MinimumSize = new System.Drawing.Size(337, 246);
+            this.Name = "Form2";
+            this.Text = "Logins";
+            this.Load += new System.EventHandler(this.Form2_Load);
+            this.ResumeLayout(false);
+            this.PerformLayout();
+
+        }
+
+        #endregion
+
+        private System.Windows.Forms.ListBox Logins;
+        private System.Windows.Forms.TextBox textBox1;
+        private System.Windows.Forms.Button select_login;
+        private System.Windows.Forms.Button remove_login;
+        private System.Windows.Forms.Button button1;
+        private System.Windows.Forms.Button button2;
+    }
+}

OnePass/Form2.cs

@@ -0,0 +1,132 @@
+using System;
+using System.Collections.Generic;
+using System.IO;
+using System.Windows.Forms;
+using System.IO.Compression;
+using System.Globalization;
+
+namespace OnePass
+{
+    public partial class Form2 : Form
+    {
+        public string site { get; set; }
+        public string login { get; set; }
+        public bool opt6 { get; set; }
+        public bool opt5 { get; set; }
+        public bool opt4 { get; set; }
+        public bool opt3 { get; set; }
+        public bool opt2 { get; set; }
+        public bool opt1 { get; set; }
+        public int length { get; set; }
+        public int cycle { get; set; }
+        public bool state { get; set; }
+        public string path { get; }
+        public string desktop = Path.Combine(Environment.GetFolderPath(Environment.SpecialFolder.Desktop));
+        List<string> files = new List<string>();
+        public Form2()
+        {
+            path = Path.Combine(Environment.GetFolderPath(Environment.SpecialFolder.ApplicationData), "OnePassData\\");
+            InitializeComponent();
+        }
+        public void init()
+        {
+            Logins.Items.Clear();
+            files.Clear();
+            string[] _files = Directory.GetFiles(path);
+            try
+            {
+                for (int i = 0; i < _files.Length; i++)
+                {
+                    files.Add(_files[i]);
+                    BinaryReader reader = new BinaryReader(File.Open(_files[i], FileMode.Open));
+                    site = new string(reader.ReadChars(reader.ReadByte()));
+                    login = new string(reader.ReadChars(reader.ReadByte()));
+                    Logins.Items.Add(site + ": " + login);
+                    reader.Dispose();
+                }
+            }
+            catch (Exception e)
+            {
+                MessageBox.Show(e.Message);
+            }
+        }
+        private void close(bool s=true)
+        {
+            state = s;
+            Visible = false;
+        }
+        private void select_login_Click(object sender, EventArgs e)
+        {
+            try
+            {
+                BinaryReader reader = new BinaryReader(File.Open(files[Logins.SelectedIndex],FileMode.Open));
+
+                site = reader.ReadString();
+                login = reader.ReadString();
+                cycle = reader.ReadInt32();
+                length = reader.ReadInt32();
+                opt1 = reader.ReadBoolean();
+                opt2 = reader.ReadBoolean();
+                opt3 = reader.ReadBoolean();
+                opt4 = reader.ReadBoolean();
+                opt5 = reader.ReadBoolean();
+                opt6 = reader.ReadBoolean();
+                reader.Dispose();
+            }
+            catch (Exception ex)
+            {
+                MessageBox.Show(ex.Message);
+                close(false);
+            }
+            close(true);
+        }
+        private void remove_login_Click(object sender, EventArgs e)
+        {
+            if (Logins.SelectedIndex < 0) return;
+            DialogResult dialogResult = MessageBox.Show("Are you sure you want to remove: " + files[Logins.SelectedIndex], "Delete?", MessageBoxButtons.YesNo);
+            if (dialogResult == DialogResult.Yes)
+            {
+                File.Delete(files[Logins.SelectedIndex]);
+                init();
+            }
+        }
+        //Export
+        private void button1_Click(object sender, EventArgs e)
+        {
+            string filename = "logins_" + DateTime.Now.ToString("MM-dd-yy (hhmmss)") + ".onp";
+            try
+            {
+                ZipFile.CreateFromDirectory(path, Path.Combine(desktop, filename));
+                MessageBox.Show("Export has been saved to: " + Path.Combine(desktop, filename));
+            } catch
+            {
+                MessageBox.Show("An export already exists! " + Path.Combine(desktop, filename));
+            }
+        }
+        //Import
+        private void button2_Click(object sender, EventArgs e)
+        {
+            OpenFileDialog openDialog = new OpenFileDialog();
+            openDialog.Title = "Select A File";
+            openDialog.Filter = "Onepass Files (*.onp)|*.onp" + "|" +
+                                "All Files (*.*)|*.*";
+            try
+            {
+                if (openDialog.ShowDialog() == DialogResult.OK)
+                {
+                    ZipFile.ExtractToDirectory(openDialog.FileName, path);
+                    init();
+                }
+            }
+            catch
+            {
+                MessageBox.Show("Invalid file selected!");
+            }
+        }
+
+        private void Form2_Load(object sender, EventArgs e)
+        {
+            //
+        }
+    }
+}

OnePass/OnePass.csproj

@@ -12,6 +12,7 @@
     <FileAlignment>512</FileAlignment>
     <AutoGenerateBindingRedirects>true</AutoGenerateBindingRedirects>
     <Deterministic>true</Deterministic>
+    <TargetFrameworkProfile />
   </PropertyGroup>
   <PropertyGroup Condition=" '$(Configuration)|$(Platform)' == 'Debug|AnyCPU' ">
     <PlatformTarget>AnyCPU</PlatformTarget>
@@ -36,8 +37,20 @@
     <ApplicationIcon>lock-clipart-cliparti1_lock-clip-art_02.ico</ApplicationIcon>
   </PropertyGroup>
   <ItemGroup>
+    <Reference Include="Microsoft.WindowsAPICodePack, Version=1.1.0.0, Culture=neutral, processorArchitecture=MSIL">
+      <HintPath>..\packages\Microsoft.WindowsAPICodePack-Core.1.1.0.0\lib\Microsoft.WindowsAPICodePack.dll</HintPath>
+    </Reference>
+    <Reference Include="Microsoft.WindowsAPICodePack.Shell, Version=1.1.0.0, Culture=neutral, processorArchitecture=MSIL">
+      <HintPath>..\packages\Microsoft.WindowsAPICodePack-Shell.1.1.0.0\lib\Microsoft.WindowsAPICodePack.Shell.dll</HintPath>
+    </Reference>
+    <Reference Include="Microsoft.WindowsAPICodePack.ShellExtensions, Version=1.1.0.0, Culture=neutral, processorArchitecture=MSIL">
+      <HintPath>..\packages\Microsoft.WindowsAPICodePack-Shell.1.1.0.0\lib\Microsoft.WindowsAPICodePack.ShellExtensions.dll</HintPath>
+    </Reference>
+    <Reference Include="PresentationCore" />
+    <Reference Include="PresentationFramework" />
     <Reference Include="System" />
     <Reference Include="System.Core" />
+    <Reference Include="System.IO.Compression.FileSystem" />
     <Reference Include="System.Xml.Linq" />
     <Reference Include="System.Data.DataSetExtensions" />
     <Reference Include="Microsoft.CSharp" />
@@ -47,6 +60,7 @@
     <Reference Include="System.Net.Http" />
     <Reference Include="System.Windows.Forms" />
     <Reference Include="System.Xml" />
+    <Reference Include="WindowsBase" />
   </ItemGroup>
   <ItemGroup>
     <Compile Include="Form1.cs">
@@ -55,11 +69,20 @@
     <Compile Include="Form1.Designer.cs">
       <DependentUpon>Form1.cs</DependentUpon>
     </Compile>
+    <Compile Include="Form2.cs">
+      <SubType>Form</SubType>
+    </Compile>
+    <Compile Include="Form2.Designer.cs">
+      <DependentUpon>Form2.cs</DependentUpon>
+    </Compile>
     <Compile Include="Program.cs" />
     <Compile Include="Properties\AssemblyInfo.cs" />
     <EmbeddedResource Include="Form1.resx">
       <DependentUpon>Form1.cs</DependentUpon>
     </EmbeddedResource>
+    <EmbeddedResource Include="Form2.resx">
+      <DependentUpon>Form2.cs</DependentUpon>
+    </EmbeddedResource>
     <EmbeddedResource Include="Properties\Resources.resx">
       <Generator>ResXFileCodeGenerator</Generator>
       <LastGenOutput>Resources.Designer.cs</LastGenOutput>
@@ -68,7 +91,9 @@
     <Compile Include="Properties\Resources.Designer.cs">
       <AutoGen>True</AutoGen>
       <DependentUpon>Resources.resx</DependentUpon>
+      <DesignTime>True</DesignTime>
     </Compile>
+    <None Include="packages.config" />
     <None Include="Properties\Settings.settings">
       <Generator>SettingsSingleFileGenerator</Generator>
       <LastGenOutput>Settings.Designer.cs</LastGenOutput>

OnePass/Properties/Resources.Designer.cs

@@ -8,9 +8,10 @@
 // </auto-generated>
 //------------------------------------------------------------------------------
 
-
-namespace OnePass.Properties
-{
+namespace OnePass.Properties {
+    using System;
+    
+    
     /// <summary>
     ///   A strongly-typed resource class, for looking up localized strings, etc.
     /// </summary>
@@ -18,53 +19,54 @@ namespace OnePass.Properties
     // class via a tool like ResGen or Visual Studio.
     // To add or remove a member, edit your .ResX file then rerun ResGen
     // with the /str option, or rebuild your VS project.
-    [global::System.CodeDom.Compiler.GeneratedCodeAttribute("System.Resources.Tools.StronglyTypedResourceBuilder", "4.0.0.0")]
+    [global::System.CodeDom.Compiler.GeneratedCodeAttribute("System.Resources.Tools.StronglyTypedResourceBuilder", "17.0.0.0")]
     [global::System.Diagnostics.DebuggerNonUserCodeAttribute()]
     [global::System.Runtime.CompilerServices.CompilerGeneratedAttribute()]
-    internal class Resources
-    {
-
+    internal class Resources {
+        
         private static global::System.Resources.ResourceManager resourceMan;
-
+        
         private static global::System.Globalization.CultureInfo resourceCulture;
-
+        
         [global::System.Diagnostics.CodeAnalysis.SuppressMessageAttribute("Microsoft.Performance", "CA1811:AvoidUncalledPrivateCode")]
-        internal Resources()
-        {
+        internal Resources() {
         }
-
+        
         /// <summary>
         ///   Returns the cached ResourceManager instance used by this class.
         /// </summary>
         [global::System.ComponentModel.EditorBrowsableAttribute(global::System.ComponentModel.EditorBrowsableState.Advanced)]
-        internal static global::System.Resources.ResourceManager ResourceManager
-        {
-            get
-            {
-                if ((resourceMan == null))
-                {
+        internal static global::System.Resources.ResourceManager ResourceManager {
+            get {
+                if (object.ReferenceEquals(resourceMan, null)) {
                     global::System.Resources.ResourceManager temp = new global::System.Resources.ResourceManager("OnePass.Properties.Resources", typeof(Resources).Assembly);
                     resourceMan = temp;
                 }
                 return resourceMan;
             }
         }
-
+        
         /// <summary>
         ///   Overrides the current thread's CurrentUICulture property for all
         ///   resource lookups using this strongly typed resource class.
         /// </summary>
         [global::System.ComponentModel.EditorBrowsableAttribute(global::System.ComponentModel.EditorBrowsableState.Advanced)]
-        internal static global::System.Globalization.CultureInfo Culture
-        {
-            get
-            {
+        internal static global::System.Globalization.CultureInfo Culture {
+            get {
                 return resourceCulture;
             }
-            set
-            {
+            set {
                 resourceCulture = value;
             }
         }
+        
+        /// <summary>
+        ///   Looks up a localized string similar to 5.2.1.
+        /// </summary>
+        internal static string Version {
+            get {
+                return ResourceManager.GetString("Version", resourceCulture);
+            }
+        }
     }
 }

OnePass/Properties/Resources.resx

@@ -46,7 +46,7 @@
     
     mimetype: application/x-microsoft.net.object.binary.base64
     value   : The object must be serialized with 
-            : System.Serialization.Formatters.Binary.BinaryFormatter
+            : System.Runtime.Serialization.Formatters.Binary.BinaryFormatter
             : and then encoded with base64 encoding.
     
     mimetype: application/x-microsoft.net.object.soap.base64
@@ -60,6 +60,7 @@
             : and then encoded with base64 encoding.
     -->
   <xsd:schema id="root" xmlns="" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:msdata="urn:schemas-microsoft-com:xml-msdata">
+    <xsd:import namespace="http://www.w3.org/XML/1998/namespace" />
     <xsd:element name="root" msdata:IsDataSet="true">
       <xsd:complexType>
         <xsd:choice maxOccurs="unbounded">
@@ -68,9 +69,10 @@
               <xsd:sequence>
                 <xsd:element name="value" type="xsd:string" minOccurs="0" />
               </xsd:sequence>
-              <xsd:attribute name="name" type="xsd:string" />
+              <xsd:attribute name="name" use="required" type="xsd:string" />
               <xsd:attribute name="type" type="xsd:string" />
               <xsd:attribute name="mimetype" type="xsd:string" />
+              <xsd:attribute ref="xml:space" />
             </xsd:complexType>
           </xsd:element>
           <xsd:element name="assembly">
@@ -85,9 +87,10 @@
                 <xsd:element name="value" type="xsd:string" minOccurs="0" msdata:Ordinal="1" />
                 <xsd:element name="comment" type="xsd:string" minOccurs="0" msdata:Ordinal="2" />
               </xsd:sequence>
-              <xsd:attribute name="name" type="xsd:string" msdata:Ordinal="1" />
+              <xsd:attribute name="name" type="xsd:string" use="required" msdata:Ordinal="1" />
               <xsd:attribute name="type" type="xsd:string" msdata:Ordinal="3" />
               <xsd:attribute name="mimetype" type="xsd:string" msdata:Ordinal="4" />
+              <xsd:attribute ref="xml:space" />
             </xsd:complexType>
           </xsd:element>
           <xsd:element name="resheader">
@@ -109,9 +112,12 @@
     <value>2.0</value>
   </resheader>
   <resheader name="reader">
-    <value>System.Resources.ResXResourceReader, System.Windows.Forms, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>
+    <value>System.Resources.ResXResourceReader, System.Windows.Forms, Version=4.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>
   </resheader>
   <resheader name="writer">
-    <value>System.Resources.ResXResourceWriter, System.Windows.Forms, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>
+    <value>System.Resources.ResXResourceWriter, System.Windows.Forms, Version=4.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089</value>
   </resheader>
+  <data name="Version" xml:space="preserve">
+    <value>5.2.1</value>
+  </data>
 </root>

OnePass/Properties/Settings.Designer.cs

@@ -8,20 +8,17 @@
 // </auto-generated>
 //------------------------------------------------------------------------------
 
-
-namespace OnePass.Properties
-{
+namespace OnePass.Properties {
+    
+    
     [global::System.Runtime.CompilerServices.CompilerGeneratedAttribute()]
-    [global::System.CodeDom.Compiler.GeneratedCodeAttribute("Microsoft.VisualStudio.Editors.SettingsDesigner.SettingsSingleFileGenerator", "11.0.0.0")]
-    internal sealed partial class Settings : global::System.Configuration.ApplicationSettingsBase
-    {
-
+    [global::System.CodeDom.Compiler.GeneratedCodeAttribute("Microsoft.VisualStudio.Editors.SettingsDesigner.SettingsSingleFileGenerator", "16.10.0.0")]
+    internal sealed partial class Settings : global::System.Configuration.ApplicationSettingsBase {
+        
         private static Settings defaultInstance = ((Settings)(global::System.Configuration.ApplicationSettingsBase.Synchronized(new Settings())));
-
-        public static Settings Default
-        {
-            get
-            {
+        
+        public static Settings Default {
+            get {
                 return defaultInstance;
             }
         }

OnePass/bin/Debug/OnePass.exe.config

@@ -1,6 +1,6 @@
-<?xml version="1.0" encoding="utf-8" ?>
+<?xml version="1.0" encoding="utf-8"?>
 <configuration>
     <startup> 
-        <supportedRuntime version="v4.0" sku=".NETFramework,Version=v4.7.2" />
+        <supportedRuntime version="v4.0" sku=".NETFramework,Version=v4.7.2"/>
     </startup>
-</configuration>
+</configuration>

OnePass/bin/Release/OnePass.exe.config

@@ -1,6 +1,6 @@
-<?xml version="1.0" encoding="utf-8" ?>
+<?xml version="1.0" encoding="utf-8"?>
 <configuration>
     <startup> 
-        <supportedRuntime version="v4.0" sku=".NETFramework,Version=v4.7.2" />
+        <supportedRuntime version="v4.0" sku=".NETFramework,Version=v4.7.2"/>
     </startup>
-</configuration>
+</configuration>

OnePass/obj/Debug/OnePass.csproj.CoreCompileInputs.cache

@@ -1 +1 @@
-8069502011d0681850e57a53d5a1673222f430a6
+00e520602f451cc44711f2d82caabf1b2656ae6e

OnePass/obj/Debug/OnePass.csproj.FileListAbsolute.txt

@@ -8,3 +8,25 @@ C:\Users\rayam\source\repos\OnePass\OnePass\obj\Debug\OnePass.csproj.GenerateRes
 C:\Users\rayam\source\repos\OnePass\OnePass\obj\Debug\OnePass.csproj.CoreCompileInputs.cache
 C:\Users\rayam\source\repos\OnePass\OnePass\obj\Debug\OnePass.exe
 C:\Users\rayam\source\repos\OnePass\OnePass\obj\Debug\OnePass.pdb
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\OnePass.exe.config
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\OnePass.exe
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\OnePass.pdb
+G:\VSCWorkspace\OnePass\OnePass\obj\Debug\OnePass.csproj.AssemblyReference.cache
+G:\VSCWorkspace\OnePass\OnePass\obj\Debug\OnePass.Form1.resources
+G:\VSCWorkspace\OnePass\OnePass\obj\Debug\OnePass.Form2.resources
+G:\VSCWorkspace\OnePass\OnePass\obj\Debug\OnePass.Properties.Resources.resources
+G:\VSCWorkspace\OnePass\OnePass\obj\Debug\OnePass.csproj.GenerateResource.cache
+G:\VSCWorkspace\OnePass\OnePass\obj\Debug\OnePass.csproj.CoreCompileInputs.cache
+G:\VSCWorkspace\OnePass\OnePass\obj\Debug\OnePass.exe
+G:\VSCWorkspace\OnePass\OnePass\obj\Debug\OnePass.pdb
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\Microsoft.WindowsAPICodePack.dll
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\Microsoft.WindowsAPICodePack.Shell.dll
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\Microsoft.WindowsAPICodePack.ShellExtensions.dll
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\Microsoft.WindowsAPICodePack.pdb
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\Microsoft.WindowsAPICodePack.xml
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\Microsoft.WindowsAPICodePack.Shell.pdb
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\Microsoft.WindowsAPICodePack.Shell.xml
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\Microsoft.WindowsAPICodePack.ShellExtensions.pdb
+G:\VSCWorkspace\OnePass\OnePass\bin\Debug\Microsoft.WindowsAPICodePack.ShellExtensions.xml
+G:\VSCWorkspace\OnePass\OnePass\obj\Debug\OnePass.csproj.CopyComplete
+G:\VSCWorkspace\OnePass\OnePass\obj\Debug\OnePass.csproj.SuggestedBindingRedirects.cache

OnePass/obj/Release/OnePass.csproj.CoreCompileInputs.cache

@@ -1 +1 @@
-a05b2efad1c492f69cfd9e73a7de2300da2b5b0d
+588963e82696ec91ef7422751ab3c9923aeb5ce7

OnePass/obj/Release/OnePass.csproj.FileListAbsolute.txt

@@ -11,10 +11,54 @@ C:\Users\rayam\source\repos\OnePass\OnePass\obj\Release\OnePass.pdb
 F:\VSCWorkspace\OnePass\OnePass\bin\Release\OnePass.exe.config
 F:\VSCWorkspace\OnePass\OnePass\bin\Release\OnePass.exe
 F:\VSCWorkspace\OnePass\OnePass\bin\Release\OnePass.pdb
-F:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csprojAssemblyReference.cache
 F:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.Form1.resources
 F:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.Properties.Resources.resources
 F:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.GenerateResource.cache
 F:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.CoreCompileInputs.cache
 F:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.exe
 F:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.pdb
+F:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.Form2.resources
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\OnePass.exe.config
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\OnePass.exe
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\OnePass.pdb
+G:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.Form1.resources
+G:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.Form2.resources
+G:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.Properties.Resources.resources
+G:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.GenerateResource.cache
+G:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.CoreCompileInputs.cache
+G:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.exe
+G:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.pdb
+G:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.AssemblyReference.cache
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.dll
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.Shell.dll
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.ShellExtensions.dll
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.pdb
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.xml
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.Shell.pdb
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.Shell.xml
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.ShellExtensions.pdb
+G:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.ShellExtensions.xml
+G:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.SuggestedBindingRedirects.cache
+G:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.CopyComplete
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\OnePass.exe.config
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\OnePass.exe
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\OnePass.pdb
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.dll
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.Shell.dll
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.ShellExtensions.dll
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.pdb
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.xml
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.Shell.pdb
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.Shell.xml
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.ShellExtensions.pdb
+D:\VSCWorkspace\OnePass\OnePass\bin\Release\Microsoft.WindowsAPICodePack.ShellExtensions.xml
+D:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.AssemblyReference.cache
+D:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.SuggestedBindingRedirects.cache
+D:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.Form1.resources
+D:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.Form2.resources
+D:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.Properties.Resources.resources
+D:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.GenerateResource.cache
+D:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.CoreCompileInputs.cache
+D:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.csproj.CopyComplete
+D:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.exe
+D:\VSCWorkspace\OnePass\OnePass\obj\Release\OnePass.pdb

OnePass/packages.config

@@ -0,0 +1,5 @@
+<?xml version="1.0" encoding="utf-8"?>
+<packages>
+  <package id="Microsoft.WindowsAPICodePack-Core" version="1.1.0.0" targetFramework="net472" />
+  <package id="Microsoft.WindowsAPICodePack-Shell" version="1.1.0.0" targetFramework="net472" />
+</packages>

Readme.md

@@ -1,2 +1,7 @@
 # One Pass
-A stateless password manager
+A stateless password manager that runs as a windows application.
+
+Todo:
+- Add web support
+- Add autofill
+- Add settings menu

packages/Microsoft.WindowsAPICodePack-Shell.1.1.0.0/lib/Microsoft.WindowsAPICodePack.ShellExtensions.XML

@@ -0,0 +1,778 @@
+<?xml version="1.0"?>
+<doc>
+    <assembly>
+        <name>Microsoft.WindowsAPICodePack.ShellExtensions</name>
+    </assembly>
+    <members>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.IPreviewFromStream">
+            <summary>
+            This interface exposes the <see cref="M:Microsoft.WindowsAPICodePack.ShellExtensions.IPreviewFromStream.Load(System.IO.Stream)"/> function for initializing the 
+            Preview Handler with a <typeparamref name="Stream"/>.
+            This interface can be used in conjunction with the other intialization interfaces,
+            but only 1 will be accessed according to the priorities preset by the Windows Shell:
+            <typeparamref name="IPreviewFromStream"/>
+            <typeparamref name="IPreviewFromShellObject"/>
+            <typeparamref name="IPreviewFromFile"/>
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.IPreviewFromStream.Load(System.IO.Stream)">
+            <summary>
+            Provides the <typeparamref name="Stream"/> to the item from which a preview should be created.        
+            </summary>
+            <param name="stream">Stream to the previewed file, this stream is only available in the scope of this method.</param>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.IPreviewFromFile">
+            <summary>
+            This interface exposes the <see cref="M:Microsoft.WindowsAPICodePack.ShellExtensions.IPreviewFromFile.Load(System.IO.FileInfo)"/> function for initializing the 
+            Preview Handler with a <typeparamref name="FileInfo"/>.
+            This interface can be used in conjunction with the other intialization interfaces,
+            but only 1 will be accessed according to the priorities preset by the Windows Shell:
+            <typeparamref name="IPreviewFromStream"/>
+            <typeparamref name="IPreviewFromShellObject"/>
+            <typeparamref name="IPreviewFromFile"/>
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.IPreviewFromFile.Load(System.IO.FileInfo)">
+            <summary>
+            Provides the <typeparamref name="FileInfo"/> to the item from which a preview should be created.        
+            </summary>
+            <param name="info">File information to the previewed file.</param>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.IPreviewFromShellObject">
+            <summary>
+            This interface exposes the <see cref="M:Microsoft.WindowsAPICodePack.ShellExtensions.IPreviewFromShellObject.Load(Microsoft.WindowsAPICodePack.Shell.ShellObject)"/> function for initializing the 
+            Preview Handler with a <typeparamref name="ShellObject"/>.
+            This interface can be used in conjunction with the other intialization interfaces,
+            but only 1 will be accessed according to the priorities preset by the Windows Shell:
+            <typeparamref name="IPreviewFromStream"/>
+            <typeparamref name="IPreviewFromShellObject"/>
+            <typeparamref name="IPreviewFromFile"/>
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.IPreviewFromShellObject.Load(Microsoft.WindowsAPICodePack.Shell.ShellObject)">
+            <summary>
+            Provides the <typeparamref name="ShellObject"/> from which a preview should be created.        
+            </summary>
+            <param name="shellObject">ShellObject for the previewed file, this ShellObject is only available in the scope of this method.</param>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler">
+            <summary>
+            This is the base class for all preview handlers and provides their basic functionality.
+            To create a custom preview handler a class must derive from this, use the <typeparamref name="PreviewHandlerAttribute"/>,
+            and implement 1 or more of the following interfaces: 
+            <typeparamref name="IPreviewFromStream"/>, 
+            <typeparamref name="IPreviewFromShellObject"/>, 
+            <typeparamref name="IPreviewFromFile"/>.   
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.IInitializeWithStream">
+            <summary>
+            Provides means by which to initialize with a stream.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.IInitializeWithStream.Initialize(System.Runtime.InteropServices.ComTypes.IStream,Microsoft.WindowsAPICodePack.Shell.AccessModes)">
+            <summary>
+            Initializes with a stream.
+            </summary>
+            <param name="stream"></param>
+            <param name="fileMode"></param>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.IInitializeWithItem">
+            <summary>
+            Provides means by which to initialize with a ShellObject
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.IInitializeWithItem.Initialize(Microsoft.WindowsAPICodePack.Shell.IShellItem,Microsoft.WindowsAPICodePack.Shell.AccessModes)">
+            <summary>
+            Initializes with ShellItem
+            </summary>
+            <param name="shellItem"></param>
+            <param name="accessMode"></param>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.IInitializeWithFile">
+            <summary>
+            Provides means by which to initialize with a file.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.IInitializeWithFile.Initialize(System.String,Microsoft.WindowsAPICodePack.Shell.AccessModes)">
+            <summary>
+            Initializes with a file.
+            </summary>
+            <param name="filePath"></param>
+            <param name="fileMode"></param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.Initialize">
+            <summary>
+            Called immediately before the preview is to be shown.        
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.Uninitialize">
+            <summary>
+            Called when the preview is no longer shown.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.UpdateBounds(Microsoft.WindowsAPICodePack.Shell.NativeRect)">
+            <summary>
+            Called to update the bounds and position of the preview control
+            </summary>
+            <param name="bounds"></param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.HandleInitializeException(System.Exception)">
+            <summary>
+            Called when an exception occurs during the initialization of the control
+            </summary>
+            <param name="caughtException"></param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.SetFocus">
+            <summary>
+            Called when the preview control obtains focus.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.SetBackground(System.Int32)">
+            <summary>
+            Called when a request is received to set or change the background color according to the user's preferences.
+            </summary>
+            <param name="color">An int representing the ARGB color</param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.SetForeground(System.Int32)">
+            <summary>
+            Called when a request is received to set or change the foreground color according to the user's preferences.
+            </summary>
+            <param name="color">An int representing the ARGB color</param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.SetFont(Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont)">
+            <summary>
+            Called to set the font of the preview control according to the user's preferences.
+            </summary>
+            <param name="font"></param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.SetParentHandle(System.IntPtr)">
+            <summary>
+            Called to set the parent of the preview control.
+            </summary>
+            <param name="handle"></param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.Register(System.Type)">
+            <summary>
+            Called when the assembly is registered via RegAsm.
+            </summary>
+            <param name="registerType">Type to register.</param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.Unregister(System.Type)">
+            <summary>
+            Called when the assembly is Unregistered via RegAsm.
+            </summary>
+            <param name="registerType">Type to unregister</param>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.IsPreviewShowing">
+            <summary>
+            Gets whether the preview is currently showing
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandler.Handle">
+            <summary>
+            This should return the window handle to be displayed in the Preview.
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandlerAttribute">
+            <summary>    
+            This class attribute is applied to a Preview Handler to specify registration parameters.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandlerAttribute.#ctor(System.String,System.String,System.String)">
+            <summary>
+            Creates a new instance of the attribute.
+            </summary>
+            <param name="name">Name of the Handler</param>
+            <param name="extensions">Semi-colon-separated list of file extensions supported by the handler.</param>
+            <param name="appId">A unique guid used for process isolation.</param>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandlerAttribute.Name">
+            <summary>
+            Gets the name of the handler.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandlerAttribute.Extensions">
+            <summary>
+            Gets the semi-colon-separated list of extensions supported by the preview handler.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandlerAttribute.AppId">
+            <summary>
+            Gets the AppId associated with the handler for use with the surrogate host process.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.PreviewHandlerAttribute.DisableLowILProcessIsolation">
+            <summary>
+            Disables low integrity-level process isolation.        
+            <remarks>This should be avoided as it could be a security risk.</remarks>
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.WinFormsPreviewHandler">
+            <summary>
+            This is the base class for all WinForms-based preview handlers and provides their basic functionality.
+            To create a custom preview handler that contains a WinForms user control,
+            a class must derive from this, use the <typeparamref name="PreviewHandlerAttribute"/>,
+            and implement 1 or more of the following interfaces: 
+            <typeparamref name="IPreviewFromStream"/>, 
+            <typeparamref name="IPreviewFromShellObject"/>, 
+            <typeparamref name="IPreviewFromFile"/>.   
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.WinFormsPreviewHandler.HandleInitializeException(System.Exception)">
+            <summary>
+            Called when an exception is thrown during itialization of the preview control.
+            </summary>
+            <param name="caughtException"></param>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.WinFormsPreviewHandler.Control">
+            <summary>
+            This control must be populated by the deriving class before the preview is shown.
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.WpfPreviewHandler">
+            <summary>
+            This is the base class for all WPF-based preview handlers and provides their basic functionality.
+            To create a custom preview handler that contains a WPF user control,
+            a class must derive from this, use the <typeparamref name="PreviewHandlerAttribute"/>,
+            and implement 1 or more of the following interfaces: 
+            <typeparamref name="IPreviewFromStream"/>, 
+            <typeparamref name="IPreviewFromShellObject"/>, 
+            <typeparamref name="IPreviewFromFile"/>.   
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.WpfPreviewHandler.ThrowIfNoControl">
+            <summary>
+            Throws an exception if the Control property has not been populated.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.WpfPreviewHandler.UpdatePlacement">
+            <summary>
+            Updates the placement of the Control.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.WpfPreviewHandler.Finalize">
+            <summary>
+            Preview handler control finalizer
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.WpfPreviewHandler.Dispose">
+            <summary>
+            Disposes the control
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.WpfPreviewHandler.Dispose(System.Boolean)">
+            <summary>
+            Provides means to dispose the object.
+            When overriden, it is imperative that base.Dispose(true) is called within the implementation.
+            </summary>
+            <param name="disposing"></param>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.WpfPreviewHandler.Control">
+            <summary>
+            This control must be populated by the deriving class before the preview is shown.
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.IThumbnailProvider">
+            <summary>
+            ComVisible interface for native IThumbnailProvider
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.IThumbnailProvider.GetThumbnail(System.UInt32,System.IntPtr@,System.UInt32@)">
+            <summary>
+            Gets a pointer to a bitmap to display as a thumbnail
+            </summary>
+            <param name="squareLength"></param>
+            <param name="bitmapHandle"></param>
+            <param name="bitmapType"></param>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont">
+            <summary>
+            Class for marshaling to native LogFont struct
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.Height">
+            <summary>
+            Font height
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.Width">
+            <summary>
+            Font width
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.Escapement">
+            <summary>
+            Font escapement
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.Orientation">
+            <summary>
+            Font orientation
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.Weight">
+            <summary>
+            Font weight
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.Italic">
+            <summary>
+            Font italic
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.Underline">
+            <summary>
+            Font underline
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.Strikeout">
+            <summary>
+            Font strikeout
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.CharacterSet">
+            <summary>
+            Font character set
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.OutPrecision">
+            <summary>
+            Font out precision
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.ClipPrecision">
+            <summary>
+            Font clip precision
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.Quality">
+            <summary>
+            Font quality
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.PitchAndFamily">
+            <summary>
+            Font pitch and family
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Interop.LogFont.FaceName">
+            <summary>
+            Font face name
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages">
+            <summary>
+              A strongly-typed resource class, for looking up localized strings, etc.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.ResourceManager">
+            <summary>
+              Returns the cached ResourceManager instance used by this class.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.Culture">
+            <summary>
+              Overrides the current thread's CurrentUICulture property for all
+              resource lookups using this strongly typed resource class.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.PreviewHandlerControlNotInitialized">
+            <summary>
+              Looks up a localized string similar to Control has not yet been assigned. Methods requiring it cannot be called..
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.PreviewHandlerInterfaceNotImplemented">
+            <summary>
+              Looks up a localized string similar to {0} must implement one or more of IPreviewFromStream, IPreviewFromShellObject or IPreviewFromFile..
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.PreviewHandlerInvalidAttributes">
+            <summary>
+              Looks up a localized string similar to PreviewHandler &apos;{0}&apos; must have exactly one PreviewHandler attribute..
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.PreviewHandlerUnsupportedInterfaceCalled">
+            <summary>
+              Looks up a localized string similar to Unable to call interface {0} because it is not supported on this object..
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.StorageStreamBufferOverflow">
+            <summary>
+              Looks up a localized string similar to The sum of offset and count must be less than or equal to the size of the buffer..
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.StorageStreamCountLessThanZero">
+            <summary>
+              Looks up a localized string similar to Count must be greater than or equal to zero..
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.StorageStreamIsReadonly">
+            <summary>
+              Looks up a localized string similar to The stream was initialized as read-only..
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.StorageStreamOffsetLessThanZero">
+            <summary>
+              Looks up a localized string similar to Offset must be greater than or equal to zero..
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.ThumbnailProviderDisabledProcessIsolation">
+            <summary>
+              Looks up a localized string similar to {0} does not implement IThumbnailFromStream and so requires DisableProcessIsolation set to true..
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.ThumbnailProviderInterfaceNotImplemented">
+            <summary>
+              Looks up a localized string similar to {0} must implement one or more of IThumbnailFromStream, IThumbnailFromShellObject or IThumbnailFromFile..
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.Resources.LocalizedMessages.WpfPreviewHandlerNoHandle">
+            <summary>
+              Looks up a localized string similar to Cannot retrieve handle because proxy window has not been created..
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream">
+            <summary>
+            A wrapper for the native IStream object.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.ReadByte">
+            <summary>
+            Reads a single byte from the stream, moving the current position ahead by 1.
+            </summary>
+            <returns>A single byte from the stream, -1 if end of stream.</returns>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.WriteByte(System.Byte)">
+            <summary>
+            Writes a single byte to the stream
+            </summary>
+            <param name="value">Byte to write to stream</param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.Read(System.Byte[],System.Int32,System.Int32)">
+            <summary>
+            Reads a buffer worth of bytes from the stream.
+            </summary>
+            <param name="buffer">Buffer to fill</param>
+            <param name="offset">Offset to start filling in the buffer</param>
+            <param name="count">Number of bytes to read from the stream</param>
+            <returns></returns>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.Write(System.Byte[],System.Int32,System.Int32)">
+            <summary>
+            Writes a buffer to the stream if able to do so.
+            </summary>
+            <param name="buffer">Buffer to write</param>
+            <param name="offset">Offset in buffer to start writing</param>
+            <param name="count">Number of bytes to write to the stream</param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.Seek(System.Int64,System.IO.SeekOrigin)">
+            <summary>
+            Seeks within the underlying IStream.
+            </summary>
+            <param name="offset">Offset</param>
+            <param name="origin">Where to start seeking</param>
+            <returns></returns>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.SetLength(System.Int64)">
+            <summary>
+            Sets the length of the stream
+            </summary>
+            <param name="value"></param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.Flush">
+            <summary>
+            Commits data to be written to the stream if it is being cached.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.Dispose(System.Boolean)">
+            <summary>
+            Disposes the stream.
+            </summary>
+            <param name="disposing">True if called from Dispose(), false if called from finalizer.</param>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.CanRead">
+            <summary>
+            Gets whether the stream can be read from.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.CanSeek">
+            <summary>
+            Gets whether seeking is supported by the stream.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.CanWrite">
+            <summary>
+            Gets whether the stream can be written to.
+            Always false.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.Length">
+            <summary>
+            Gets the length of the IStream
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStream.Position">
+            <summary>
+            Gets or sets the current position within the underlying IStream.
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStreamCommitOptions">
+            <summary>
+            Options for commiting (flushing) an IStream storage stream
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStreamCommitOptions.None">
+            <summary>
+            Uses default options
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStreamCommitOptions.Overwrite">
+            <summary>
+            Overwrite option
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStreamCommitOptions.OnlyIfCurrent">
+            <summary>
+            Only if current
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStreamCommitOptions.DangerouslyCommitMerelyToDiskCache">
+            <summary>
+            Commits to disk cache dangerously
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.StorageStreamCommitOptions.Consolidate">
+            <summary>
+            Consolidate
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.IThumbnailFromStream">
+            <summary>
+            This interface exposes the <see cref="!:ConsructBitmap"/> function for initializing the 
+            Thumbnail Provider with a <typeparamref name="Stream"/>.
+            If this interfaces is not used, then the handler must opt out of process isolation.
+            This interface can be used in conjunction with the other intialization interfaces,
+            but only 1 will be accessed according to the priorities preset by the Windows Shell:
+            <typeparamref name="IThumbnailFromStream"/>
+            <typeparamref name="IThumbnailFromShellObject"/>
+            <typeparamref name="IThumbnailFromFile"/>
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.IThumbnailFromStream.ConstructBitmap(System.IO.Stream,System.Int32)">
+            <summary>
+            Provides the <typeparamref name="Stream"/> to the item from which a thumbnail should be created.
+            <remarks>Only 32bpp bitmaps support adornments. 
+            While 24bpp bitmaps will be displayed they will not display adornments.
+            Additional guidelines for developing thumbnails can be found at http://msdn.microsoft.com/en-us/library/cc144115(v=VS.85).aspx
+            </remarks>
+            </summary>
+            <param name="stream">Stream to initialize the thumbnail</param>
+            <param name="sideSize">Square side dimension in which the thumbnail should fit; the thumbnail will be scaled otherwise.</param>
+            <returns></returns>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.IThumbnailFromShellObject">
+            <summary>
+            This interface exposes the <see cref="!:ConsructBitmap"/> function for initializing the 
+            Thumbnail Provider with a <typeparamref name="ShellObject"/>.
+            This interface can be used in conjunction with the other intialization interfaces,
+            but only 1 will be accessed according to the priorities preset by the Windows Shell:
+            <typeparamref name="IThumbnailFromStream"/>
+            <typeparamref name="IThumbnailFromShellObject"/>
+            <typeparamref name="IThumbnailFromFile"/>
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.IThumbnailFromShellObject.ConstructBitmap(Microsoft.WindowsAPICodePack.Shell.ShellObject,System.Int32)">
+            <summary>
+            Provides the <typeparamref name="ShellObject"/> to the item from which a thumbnail should be created.
+            <remarks>Only 32bpp bitmaps support adornments. 
+            While 24bpp bitmaps will be displayed they will not display adornments.
+            Additional guidelines for developing thumbnails can be found at http://msdn.microsoft.com/en-us/library/cc144115(v=VS.85).aspx
+            </remarks>
+            </summary>
+            <param name="shellObject">ShellObject to initialize the thumbnail</param>
+            <param name="sideSize">Square side dimension in which the thumbnail should fit; the thumbnail will be scaled otherwise.</param>
+            <returns>Generated thumbnail</returns>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.IThumbnailFromFile">
+            <summary>
+            This interface exposes the <see cref="!:ConsructBitmap"/> function for initializing the 
+            Thumbnail Provider with file information.
+            This interface can be used in conjunction with the other intialization interfaces,
+            but only 1 will be accessed according to the priorities preset by the Windows Shell:
+            <typeparamref name="IThumbnailFromStream"/>
+            <typeparamref name="IThumbnailFromShellObject"/>
+            <typeparamref name="IThumbnailFromFile"/>
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.IThumbnailFromFile.ConstructBitmap(System.IO.FileInfo,System.Int32)">
+            <summary>
+            Provides the <typeparamref name="FileInfo"/> to the item from which a thumbnail should be created.
+            <remarks>Only 32bpp bitmaps support adornments. 
+            While 24bpp bitmaps will be displayed they will not display adornments.
+            Additional guidelines for developing thumbnails can be found at http://msdn.microsoft.com/en-us/library/cc144115(v=VS.85).aspx
+            </remarks>
+            </summary>
+            <param name="info">FileInfo to initialize the thumbnail</param>
+            <param name="sideSize">Square side dimension in which the thumbnail should fit; the thumbnail will be scaled otherwise.</param>
+            <returns>Generated thumbnail</returns>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProvider">
+            <summary>
+            This is the base class for all thumbnail providers and provides their basic functionality.
+            To create a custom thumbnail provider a class must derive from this, use the <typeparamref name="ThumbnailProviderAttribute"/>,
+            and implement 1 or more of the following interfaces: 
+            <typeparamref name="IThumbnailFromStream"/>, <typeparamref name="IThumbnailFromShellObject"/>, <typeparamref name="IThumbnailFromFile"/>.   
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProvider.GetThumbnailAlphaType">
+            <summary>
+            Sets the AlphaType of the generated thumbnail.
+            Override this method in a derived class to change the thumbnails AlphaType, default is Unknown.
+            </summary>
+            <returns>ThumnbailAlphaType</returns>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProvider.Register(System.Type)">
+            <summary>
+            Called when the assembly is registered via RegAsm.
+            </summary>
+            <param name="registerType">Type to be registered.</param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProvider.Unregister(System.Type)">
+            <summary>
+            Called when the assembly is registered via RegAsm.
+            </summary>
+            <param name="registerType">Type to register.</param>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProvider.Finalize">
+            <summary>
+            Finalizer for the thumbnail provider.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProvider.Dispose">
+            <summary>
+            Disposes the thumbnail provider.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProvider.Dispose(System.Boolean)">
+            <summary>
+            Disploses the thumbnail provider.
+            </summary>
+            <param name="disposing"></param>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProviderAttribute">
+            <summary>    
+            This class attribute is applied to a Thumbnail Provider to specify registration parameters
+            and aesthetic attributes.
+            </summary>
+        </member>
+        <member name="M:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProviderAttribute.#ctor(System.String,System.String)">
+            <summary>
+            Creates a new instance of the attribute.
+            </summary>
+            <param name="name">Name of the provider</param>
+            <param name="extensions">Semi-colon-separated list of extensions supported by this provider.</param>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProviderAttribute.Name">
+            <summary>
+            Gets the name of the provider
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProviderAttribute.Extensions">
+            <summary>
+            Gets the semi-colon-separated list of extensions supported by the provider.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProviderAttribute.DisableProcessIsolation">
+            <summary>
+            Opts-out of running within the surrogate process DllHost.exe.
+            This will reduce robustness and security.
+            This value should be true if the provider does not implement <typeparamref name="IThumbnailFromStream"/>.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProviderAttribute.ThumbnailCutoff">
+            <summary>
+            Below this size thumbnail images will not be generated - file icons will be used instead.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProviderAttribute.TypeOverlay">
+            <summary>
+            A resource reference string pointing to the icon to be used as an overlay on the bottom right of the thumbnail.
+            ex. ISVComponent.dll@,-155
+            ex. C:\Windows\System32\SampleIcon.ico
+            If an empty string is provided, no overlay will be used.
+            If the property is set to null, the default icon for the associated icon will be used as an overlay.
+            </summary>
+        </member>
+        <member name="P:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailProviderAttribute.ThumbnailAdornment">
+            <summary>
+            Specifies the <typeparamref name="ThumbnailAdornment"/> for the thumbnail.
+            <remarks>
+            Only 32bpp bitmaps support adornments. 
+            While 24bpp bitmaps will be displayed, their adornments will not.
+            If an adornment is specified by the file-type's associated application, 
+            the applications adornment will override the value specified in this registration.</remarks>
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailCutoffSize">
+            <summary>
+            Defines the minimum thumbnail size for which thumbnails will be generated.
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailCutoffSize.Square20">
+            <summary>
+            Default size of 20x20
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailCutoffSize.Square32">
+            <summary>
+            Size of 32x32
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailCutoffSize.Square16">
+            <summary>
+            Size of 16x16
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailCutoffSize.Square48">
+            <summary>
+            Size of 48x48
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailCutoffSize.Square16B">
+            <summary>
+            Size of 16x16. An alternative to Square16.
+            </summary>
+        </member>
+        <member name="T:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailAdornment">
+            <summary>
+            Adornment applied to thumbnails.
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailAdornment.Default">
+            <summary>
+            This will use the associated application's default icon as the adornment.
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailAdornment.None">
+            <summary>
+            No adornment
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailAdornment.DropShadow">
+            <summary>
+            Drop shadow adornment
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailAdornment.PhotoBorder">
+            <summary>
+            Photo border adornment
+            </summary>
+        </member>
+        <member name="F:Microsoft.WindowsAPICodePack.ShellExtensions.ThumbnailAdornment.VideoSprockets">
+            <summary>
+            Video sprocket adornment
+            </summary>
+        </member>
+    </members>
+</doc>